-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAMBI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-152 of human BAMBI (NP_036474.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BAMBI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-152 of human BAMBI (NP_036474.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02978A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAMBI |
| Target Synonyms | NMA; BAMBI | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-152 of human BAMBI (NP_036474.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRA | Uniprot ID | Q13145 |
Uniprot Id
Q13145
Target Species
Human
Target Name
BAMBI
Target Full Name
BMP and activin membrane-bound inhibitor homolog
Target Function
Negatively regulates TGF-beta signaling.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
BAMBI family
Target Tissue Specificity
High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
Target Synonyms
BAMBI; BAMBI_HUMAN; BMP and activin membrane bound inhibitor homolog; BMP and activin membrane-bound inhibitor homolog; NMA; Non metastatic gene A protein; Non-metastatic gene A protein; Putative transmembrane protein NMA
Target Background
This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis.
Notification