-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bcl-W was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-193 of human Bcl-W (NP_004041.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Bcl-W was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-193 of human Bcl-W (NP_004041.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01971A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Bcl-W |
| Target Synonyms | BCLW; BCL-W; PPP1R51; BCL2-L-2; Bcl-W | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-193 of human Bcl-W (NP_004041.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK | Uniprot ID | Q92843 |
Uniprot Id
Q92843
Target Species
Human
Target Name
BCL2L2
Target Full Name
Bcl-2-like protein 2
Target Function
Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.
Target Subcellular Location
Mitochondrion membrane; Peripheral membrane protein. Note=Loosely associated with the mitochondrial membrane in healthy cells. During apoptosis, tightly bound to the membrane.
Target Protein Families
Bcl-2 family
Target Tissue Specificity
Expressed (at protein level) in a wide range of tissues with highest levels in brain, spinal cord, testis, pancreas, heart, spleen and mammary glands. Moderate levels found in thymus, ovary and small intestine. Not detected in salivary gland, muscle or li
Target Research Area
Cancer
Target Synonyms
Apoptosis regulator BCL W; Apoptosis regulator Bcl-W; B2CL2_HUMAN; BCL 2 Like 2; Bcl 2 like 2 protein; Bcl 2L2; BCL W; Bcl-2-like protein 2; Bcl2 L2; BCL2 like 2; BCL2 like 2 protein; Bcl2-L-2; Bcl2l2; BCLW; KIAA0271; PPP1R51; Protein phosphatase 1 regulatory subunit 51
Target Background
This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene.
Notification