-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bcl10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human Bcl10 (NP_003912.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Bcl10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human Bcl10 (NP_003912.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06559A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCL10 |
| Target Synonyms | CLAP; mE10; CIPER; IMD37; c-E10; CARMEN; Bcl10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human Bcl10 (NP_003912.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLK | Uniprot ID | O95999 |
Uniprot Id
O95999
Target Species
Human
Target Name
BCL10
Target Full Name
B-cell lymphoma/leukemia 10
Target Function
Plays a key role in both adaptive and innate immune signaling by bridging CARD domain-containing proteins to immune activation. Acts by channeling adaptive and innate immune signaling downstream of CARD domain-containing proteins CARD9, CARD11 and CARD14 to activate NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Recruited by activated CARD domain-containing proteins: homooligomerized CARD domain-containing proteins form a nucleating helical template that recruits BCL10 via CARD-CARD interaction, thereby promoting polymerization of BCL10, subsequent recruitment of MALT1 and formation of a CBM complex. This leads to activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Activated by CARD9 downstream of C-type lectin receptors; CARD9-mediated signals are essential for antifungal immunity. Activated by CARD11 downstream of T-cell receptor (TCR) and B-cell receptor (BCR). Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK.
Target Involvement
Immunodeficiency 37 (IMD37); Lymphoma, mucosa-associated lymphoid type (MALTOMA)
Target Subcellular Location
Cytoplasm, perinuclear region. Membrane raft.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Apoptosis
Target Synonyms
AI132454; B cell CLL/lymphoma 10 ; B cell lymphoma/leukemia10; B-cell CLL/lymphoma 10; B-cell leukemia/lymphoma 10; B-cell lymphoma/leukemia 10; Bcl 10; Bcl-10; Bcl10; BCL10_HUMAN; c E10; c-E10; C81403; CARD containing apoptotic signaling protein; CARD containing molecule enhancing NF kappa B; CARD containing molecule enhancing NF kB; CARD containing molecule enhancing NF-kB; CARD containing molecule enhancing NFkB ; CARD containing proapoptotic protein; CARD like apoptotic protein ; CARD-containing apoptotic signaling protein; CARD-containing molecule enhancing NF-kappa-B; CARD-containing proapoptotic protein; CARD-like apoptotic protein; CARMEN; Caspase recruiting domain containing protein ; caspase-recruiting domain-containing protein; cCARMEN; cE 10; cE10 ; CED 3/ICH 1 prodomain homologous E10 like regulator; CED-3/ICH-1 prodomain homologous E10-like regulator; CED3/ICH1 prodomain homologous E10 like regulator; Cellular E10; Cellular homolog of vCARMEN; Cellular-E10; CIPER; CLAP; hCLAP; Mammalian CARD containing adapter molecule E10; Mammalian CARD-containing adapter molecule E10; mE 10; mE10; R-RCD1
Target Background
This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants.
Notification