-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BCL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human BCL3 (NP_005169.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BCL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human BCL3 (NP_005169.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01972A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCL3 |
| Target Synonyms | BCL4; D19S37; BCL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human BCL3 (NP_005169.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS | Uniprot ID | P20749 |
Uniprot Id
P20749
Target Species
Human
Target Name
BCL3
Target Full Name
B-cell lymphoma 3 protein
Target Function
Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation.
Target Involvement
A chromosomal aberration involving BCL3 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL). Translocation t(14;19)(q32;q13.1) with immunoglobulin gene regions.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, perinuclear region.
Target Synonyms
B cell CLL/lymphoma 3; B cell leukemia/lymphoma 3; B cell lymphoma 3 encoded protein; B-cell lymphoma 3 protein; Bcl 3; BCL 4; BCL-3; Bcl3; BCL3_HUMAN; BCL4; Chronic lymphatic leukemia protein; D19S37; Protein Bcl 3; Proto-oncogene BCL3
Target Background
This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
Notification