Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BDKRB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 302-391 of human BDKRB2 (P30411) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BDKRB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 302-391 of human BDKRB2 (P30411) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13900A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BDKRB2 |
| Target Synonyms | B2R; BK2; BK-2; BKR2; BRB2; BDKRB2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 302-391 of human BDKRB2 (P30411). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ | Uniprot ID | P30411 |
Uniprot Id
P30411
Target Species
Human
Target Name
BDKRB2
Target Full Name
B2 bradykinin receptor
Target Function
Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB2 sub-subfamily
Target Tissue Specificity
Ubiquitous. Widespread in normal smooth muscle tissue and neurons.
Target Synonyms
BDKRB2; BKR2; B2 bradykinin receptor; B2R; BK-2 receptor
Target Background
This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. Bradykinin is released upon activation by pathophysiologic conditions such as trauma and inflammation, and binds to its kinin receptors, B1 and B2. The B2 receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
