-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BDNF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 129-247 of human BDNF (NP_733931.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BDNF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 129-247 of human BDNF (NP_733931.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01734A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BDNF |
| Target Synonyms | ANON2; BULN2; BDNF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 129-247 of human BDNF (NP_733931.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR | Uniprot ID | P23560 |
Uniprot Id
P23560
Target Species
Human
Target Name
BDNF
Target Full Name
Neurotrophic factor BDNF precursor form
Target Function
Important signaling molecule that activates signaling cascades downstream of NTRK2. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.; Important signaling molecule that activates signaling cascades downstream of NTRK2. Activates signaling cascades via the heterodimeric receptor formed by NGFR and SORCS2. Signaling via NGFR and SORCS2 plays a role in synaptic plasticity and long-term depression (LTD). Binding to NGFR and SORCS2 promotes neuronal apoptosis. Promotes neuronal growth cone collapse.
Target Involvement
Bulimia nervosa 2 (BULN2); Congenital central hypoventilation syndrome (CCHS)
Target Subcellular Location
Secreted.; [BDNF precursor form]: Secreted.
Target Protein Families
NGF-beta family
Target Tissue Specificity
Detected in blood plasma and in saliva (at protein level). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
Target Research Area
Neuroscience
Target Synonyms
Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin
Target Background
This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders.
Notification