-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BEST1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-270 of human BEST1 (NP_004174.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BEST1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-270 of human BEST1 (NP_004174.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00493A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BEST1 |
| Target Synonyms | ARB; BMD; BEST; RP50; VMD2; TU15B; Best1V1Delta2; BEST1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 171-270 of human BEST1 (NP_004174.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELD | Uniprot ID | O76090 |
Uniprot Id
O76090
Target Species
Human
Target Name
BEST1
Target Full Name
Bestrophin-1
Target Function
Forms calcium-sensitive chloride channels. Highly permeable to bicarbonate.
Target Involvement
Macular dystrophy, vitelliform, 2 (VMD2); Retinitis pigmentosa 50 (RP50); Bestrophinopathy, autosomal recessive (ARB); Vitreoretinochoroidopathy, autosomal dominant (ADVIRC)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Target Protein Families
Bestrophin family
Target Tissue Specificity
Predominantly expressed in the basolateral membrane of the retinal pigment epithelium.
Target Synonyms
BEST1; VMD2; Bestrophin-1; TU15B; Vitelliform macular dystrophy protein 2
Target Background
This gene encodes a member of the bestrophin gene family. This small gene family is characterized by proteins with a highly conserved N-terminus with four to six transmembrane domains. Bestrophins may form chloride ion channels or may regulate voltage-gated L-type calcium-ion channels. Bestrophins are generally believed to form calcium-activated chloride-ion channels in epithelial cells but they have also been shown to be highly permeable to bicarbonate ion transport in retinal tissue. Mutations in this gene are responsible for juvenile-onset vitelliform macular dystrophy (VMD2), also known as Best macular dystrophy, in addition to adult-onset vitelliform macular dystrophy (AVMD) and other retinopathies. Alternative splicing results in multiple variants encoding distinct isoforms.
Notification