-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BHLHE40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 121-300 of human BHLHE40 (NP_003661.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BHLHE40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 121-300 of human BHLHE40 (NP_003661.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11098A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BHLHE40 |
| Target Synonyms | DEC1; HLHB2; BHLHB2; Clast5; SHARP2; STRA13; Stra14; SHARP-2; BHLHE40 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 121-300 of human BHLHE40 (NP_003661.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH | Uniprot ID | O14503 |
Uniprot Id
O14503
Target Species
Human
Target Name
BHLHE40
Target Full Name
Class E basic helix-loop-helix protein 40
Target Function
Transcriptional repressor involved in the regulation of the circadian rhythm by negatively regulating the activity of the clock genes and clock-controlled genes. Acts as the negative limb of a novel autoregulatory feedback loop (DEC loop) which differs from the one formed by the PER and CRY transcriptional repressors (PER/CRY loop). Both these loops are interlocked as it represses the expression of PER1/2 and in turn is repressed by PER1/2 and CRY1/2. Represses the activity of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1|ARNTL2/BMAL2 heterodimer by competing for the binding to E-box elements (5'-CACGTG-3') found within the promoters of its target genes. Negatively regulates its own expression and the expression of DBP and BHLHE41/DEC2. Acts as a corepressor of RXR and the RXR-LXR heterodimers and represses the ligand-induced RXRA and NR1H3/LXRA transactivation activity. May be involved in the regulation of chondrocyte differentiation via the cAMP pathway. Represses the transcription of NR0B2 and attentuates the transactivation of NR0B2 by the CLOCK-ARNTL/BMAL1 complex. Drives the circadian rhythm of blood pressure through transcriptional repression of ATP1B1 in the cardiovascular system.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Expressed in cartilage, spleen, intestine, lung, and to a lesser extent in heart, brain, liver, muscle and stomach.
Target Synonyms
BHE40_HUMAN; bHLHB2; bHLHe40; Class B Basic Helix Loop Helix Protein 2; Class B basic helix-loop-helix protein 2; Class E basic helix loop helix protein 40; Class E basic helix-loop-helix protein 40; Clast5; DEC1; Differentially expressed in chondrocytes protein 1; E47 interaction protein 1; EIP1; Enhancer of split and hairy related protein 2; Enhancer-of-split and hairy-related protein 2; SHARP 2; SHARP-2; Stimulated by retinoic acid gene 13 protein; STRA13
Target Background
This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation.
Notification