-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BHLHE41 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BHLHE41 (NP_110389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BHLHE41 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BHLHE41 (NP_110389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06419A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BHLHE41 |
| Target Synonyms | DEC2; FNSS1; hDEC2; BHLHB3; SHARP1; BHLHE41 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562(Negative control), Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BHLHE41 (NP_110389.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRM | Uniprot ID | Q9C0J9 |
Uniprot Id
Q9C0J9
Target Species
Human
Target Name
BHLHE41
Target Full Name
Class E basic helix-loop-helix protein 41
Target Function
Transcriptional repressor involved in the regulation of the circadian rhythm by negatively regulating the activity of the clock genes and clock-controlled genes. Acts as the negative limb of a novel autoregulatory feedback loop (DEC loop) which differs from the one formed by the PER and CRY transcriptional repressors (PER/CRY loop). Both these loops are interlocked as it represses the expression of PER1 and in turn is repressed by PER1/2 and CRY1/2. Represses the activity of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer by competing for the binding to E-box elements (5'-CACGTG-3') found within the promoters of its target genes. Negatively regulates its own expression and the expression of DBP and BHLHE41/DEC2. Acts as a corepressor of RXR and the RXR-LXR heterodimers and represses the ligand-induced RXRA/B/G, NR1H3/LXRA, NR1H4 and VDR transactivation activity. Inhibits HNF1A-mediated transactivation of CYP1A2, CYP2E1 AND CYP3A11.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Highly expressed in skeletal muscle and brain, moderately expressed in pancreas and heart, weakly expressed in placenta, lung, liver and kidney.
Target Synonyms
Basic helix-loop-helix domain containing class B3; BHE41_HUMAN; bHLH protein DEC2; bHLHB3; bHLHe41; Class B basic helix loop helix protein 3; Class B basic helix-loop-helix protein 3; Class E basic helix-loop-helix protein 41; DEC2; Differentially expressed in chondrocytes protein 2; Enhancer of split and hairy related protein 1; Enhancer-of-split and hairy-related protein 1; hDEC2; Moderately similar to basic-helix loop helix protein M.musculus; SHARP-1
Target Background
This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. Defects in this gene are associated with the short sleep phenotype.
Notification