-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bid was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Bid (NP_001187.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Bid was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Bid (NP_001187.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16402A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BID |
| Target Synonyms | FP497; [KD Validated] Bid | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Bid (NP_001187.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD | Uniprot ID | P55957 |
Uniprot Id
P55957
Target Species
Human
Target Name
BID
Target Full Name
BH3-interacting domain death agonist
Target Function
Induces caspases and apoptosis. Counters the protective effect of BCL2.; Induces caspase activation and apoptosis. Allows the release of cytochrome c.; Induces ICE-like proteases and apoptosis.; Induces ICE-like proteases and apoptosis.; Does not induce apoptosis.; Induces ICE-like proteases and apoptosis.
Target Subcellular Location
Cytoplasm. Mitochondrion membrane. Mitochondrion outer membrane.; [BH3-interacting domain death agonist p15]: Mitochondrion membrane.; [BH3-interacting domain death agonist p13]: Mitochondrion membrane.; [Isoform 1]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 2]: Mitochondrion membrane.
Target Tissue Specificity
[Isoform 2]: Expressed in spleen, pancreas and placenta (at protein level).; [Isoform 3]: Expressed in lung, pancreas and spleen (at protein level).; [Isoform 4]: Expressed in lung and pancreas (at protein level).
Target Research Area
Apoptosis
Target Synonyms
Apoptic death agonist; Apoptotic death agonist BID; BH3 interacting domain death agonist; BH3 interacting domain death agonist p11; BH3 interacting domain death agonist p13; BH3 interacting domain death agonist p15; BH3-interacting domain death agonist p11; BID; BID isoform ES(1b); BID isoform L(2); BID isoform Si6; BID_HUMAN; Desmocollin type 4; FP497; Human BID coding sequence; MGC15319; MGC42355; p11 BID; p13 BID; p15 BID; p22 BID
Target Background
This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found.
Notification