-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BLOC1S2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-142 of human BLOC1S2 (NP_776170.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BLOC1S2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-142 of human BLOC1S2 (NP_776170.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08676A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BLOC1S2 |
| Target Synonyms | CEAP; BLOS2; BORCS2; CEAP11; BLOC1S2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 44-142 of human BLOC1S2 (NP_776170.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR | Uniprot ID | Q6QNY1 |
Uniprot Id
Q6QNY1
Target Species
Human
Target Name
BLOC1S2
Target Full Name
Biogenesis of lysosome-related organelles complex 1 subunit 2
Target Function
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. May play a role in cell proliferation.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Lysosome membrane.
Target Protein Families
BLOC1S2 family
Target Tissue Specificity
Isoform 1 and isoform 2 are widely expressed. Expressed in various malignant tumor tissues (at protein level).
Target Synonyms
Biogenesis of lysosome-related organelles complex 1 subunit 2; BL1S2_HUMAN; BLOC-1 subunit 2; Bloc1s2; BLOS2; Centrosome-associated protein; RP11 316M21.4
Target Background
This gene encodes a protein with multiple functions. The encoded protein has been found in association with the centrosome, shown to co-localize with gamma-tubulin, and also found to be one of the proteins in the BLOC-1 complex which functions in the formation of lysosome-related organelles. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
Notification