-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BMF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human BMF (NP_277038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BMF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human BMF (NP_277038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09645A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BMF |
| Target Synonyms | BMF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung, Mouse ovary, Mouse spleen, Rat liver, SW480, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human BMF (NP_277038.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR | Uniprot ID | Q96LC9 |
Uniprot Id
Q96LC9
Target Species
Human
Target Name
BMF
Target Full Name
Bcl-2-modifying factor
Target Function
May play a role in apoptosis. Isoform 1 seems to be the main initiator.
Target Protein Families
Bcl-2 family
Target Tissue Specificity
Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells.
Target Research Area
Cell Biology
Target Synonyms
Bcl 2 modifying factor; Bcl-2-modifying factor; Bcl2 modifying factor; Bmf; BMF_HUMAN; FLJ00065
Target Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification