-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BMPR1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-532 of human BMPR1B (NP_001243722.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BMPR1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-532 of human BMPR1B (NP_001243722.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07783A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BMPR1B |
| Target Synonyms | ALK6; AMD3; AMDD; BDA2; ALK-6; BDA1D; CDw293; BMPR1B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-532 of human BMPR1B (NP_001243722.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL | Uniprot ID | O00238 |
Uniprot Id
O00238
Target Species
Human
Target Name
BMPR1B
Target Full Name
Bone morphogenetic protein receptor type-1B
Target Function
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP7/OP-1 and GDF5. Positively regulates chondrocyte differentiation through GDF5 interaction.
Target Involvement
Acromesomelic dysplasia, Demirhan type (AMDD); Brachydactyly A2 (BDA2); Brachydactyly A1, D (BDA1D)
Target Subcellular Location
Cell membrane. Membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Target Synonyms
BMPR1B; Bone morphogenetic protein receptor type-1B; BMP type-1B receptor; BMPR-1B; CD antigen CDw293
Target Background
This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension. Several transcript variants encoding two different isoforms have been found for this gene.
Notification