-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BNIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human BNIP1 (NP_001196.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BNIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human BNIP1 (NP_001196.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02604A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BNIP1 |
| Target Synonyms | NIP1; SEC20; TRG-8; BNIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse testis, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human BNIP1 (NP_001196.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELT | Uniprot ID | Q12981 |
Uniprot Id
Q12981
Target Species
Human
Target Name
BNIP1
Target Full Name
Vesicle transport protein SEC20
Target Function
As part of a SNARE complex may be involved in endoplasmic reticulum membranes fusion and be required for the maintenance of endoplasmic reticulum organization. Plays also a role in apoptosis. It is for instance required for endoplasmic reticulum stress-induced apoptosis. As a substrate of RNF185 interacting with SQSTM1, might also be involved in mitochondrial autophagy (Probable).
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Mitochondrion membrane; Single-pass type IV membrane protein.
Target Protein Families
SEC20 family
Target Tissue Specificity
Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.
Target Synonyms
BCL2 adenovirus E1B 19kD interacting protein 1; BCL2/adenovirus E1B 19 kDa protein-interacting protein 1; BNIP1; MGC41600; Nip1; OTTHUMP00000161077; OTTHUMP00000161078; OTTHUMP00000161079; OTTHUMP00000223580; sec20; SEC20_HUMAN; SEC20L; Transformation-related gene 8 protein; TRG-8; TRG8; Vesicle transport protein SEC20
Target Background
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. In addition, this protein is involved in vesicle transport into the endoplasmic reticulum. Alternative splicing of this gene results in four protein products with identical N- and C-termini.
Notification