-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BNP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 35-134 of human BNP (NP_002512.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BNP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 35-134 of human BNP (NP_002512.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15443A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BNP |
| Target Synonyms | BNP; Iso-ANP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 35-134 of human BNP (NP_002512.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH | Uniprot ID | P16860 |
Uniprot Id
P16860
Target Species
Human
Target Name
NPPB
Target Full Name
Natriuretic peptides B
Target Function
Cardiac hormone that plays a key role in mediating cardio-renal homeostasis. May also function as a paracrine antifibrotic factor in the heart. Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses. Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Binds the clearance receptor NPR3.; May affect cardio-renal homeostasis. Able to promote the production of cGMP although its potency is very low compared to brain natriuretic peptide 32.; May have a role in cardio-renal homeostasis. Able to promote the production of cGMP.
Target Subcellular Location
[NT-proBNP]: Secreted.; [proBNP(3-108)]: Secreted.; [Brain natriuretic peptide 32]: Secreted.; [BNP(3-32)]: Secreted.
Target Protein Families
Natriuretic peptide family
Target Tissue Specificity
[Brain natriuretic peptide 32]: Detected in the cardiac atria (at protein level). Detected in the kidney distal tubular cells (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
ANFB_HUMAN; BNP; BNP(1-32); BNP(5-29); BNP-32; Brain type natriuretic peptide; Gamma brain natriuretic peptide; Gamma-brain natriuretic peptide; Natriuretic peptide precursor B; nppb; NT proBNP
Target Background
This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The presence of myocardial injury is a significant predictor of mortality in hospitalized coronavirus disease 2019 (COVID-19) patients, and there is evidence of increased levels of natriuretic peptide B in hospitalized non-survivor COVID-19 patients. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis.
Notification