Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BOP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-680 of human BOP1 (NP_056016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BOP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-680 of human BOP1 (NP_056016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07425A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BOP1 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | BxPC-3, Mouse liver, Rat pancreas |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-680 of human BOP1 (NP_056016.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLRHHKKALRAVAFHPRYPLFAS | Uniprot ID | Q14137 |
Uniprot Id
Q14137
Target Species
Human
Target Name
BOP1
Target Full Name
Ribosome biogenesis protein BOP1
Target Function
Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.
Target Subcellular Location
Nucleus, nucleolus. Nucleus, nucleoplasm.
Target Protein Families
WD repeat BOP1/ERB1 family
Target Synonyms
AU020183; AW146150; Block of proliferation 1; Block of proliferation 1 protein; Bop1; Bop1 block of proliferation 1 ; BOP1_HUMAN; D18861; Erb1p; Kiaa0124; MGC109114; mKIAA0124; Ribosome biogenesis protein BOP1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
