Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BRD2 (NP_005095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BRD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BRD2 (NP_005095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07233A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRD2 |
| Target Synonyms | FSH; NAT; RNF3; FSRG1; RING3; FSHRG1; D6S113E; O27.1.1; BRD2-IT1; BRD2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BRD2 (NP_005095.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFR | Uniprot ID | P25440 |
Uniprot Id
P25440
Target Species
Human
Target Name
BRD2
Target Full Name
Bromodomain-containing protein 2
Target Function
May play a role in spermatogenesis or folliculogenesis. Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.
Target Subcellular Location
Nucleus. Note=Detected on chromatin and nucleosomes.
Target Research Area
Cell Biology
Target Synonyms
BRD 2; Brd2; BRD2_HUMAN; Bromodomain containing 2; Bromodomain-containing protein 2; D6S113E; DKFZp686N0336; Female sterile homeotic related gene 1; Female sterile homeotic related gene 1; mouse; homolog of; FLJ31942; FSH; FSRG1; KIAA9001; NAT; O27.1.1; Really interesting new gene 3 protein; RING3; RING3 PROTEIN; RNF3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
