Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human BRK1 (NP_060932.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against BRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human BRK1 (NP_060932.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of BRK1 in paraffin-embedded human breast cancer using BRK1 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-02170A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRK1 |
| Target Synonyms | MDS027; hHBrk1; C3orf10; HSPC300; BRK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human BRK1 (NP_060932.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT | Uniprot ID | Q8WUW1 |
Uniprot Id
Q8WUW1
Target Species
Human
Target Name
BRK1
Target Full Name
Protein BRICK1
Target Function
Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
BRK1 family
Target Synonyms
BRK1; C3orf10; HSPC300; MDS027; Protein BRICK1; BRK1
Target Background
Enables identical protein binding activity. Contributes to small GTPase binding activity. Involved in Rac protein signal transduction and positive regulation of cellular component organization. Located in extracellular exosome. Part of SCAR complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
