-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRWD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human BRWD1 (NP_001007247.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BRWD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human BRWD1 (NP_001007247.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03172A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRWD1 |
| Target Synonyms | N143; WDR9; WRD9; DCAF19; C21orf107; BRWD1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Jurkat, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human BRWD1 (NP_001007247.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI | Uniprot ID | Q9NSI6 |
Uniprot Id
Q9NSI6
Target Species
Human
Target Name
BRWD1
Target Full Name
Bromodomain and WD repeat-containing protein 1
Target Function
May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
Bromodomain and WD repeat domain containing protein 1; Bromodomain and WD repeat-containing protein 1; Brwd1; BRWD1_HUMAN; C21orf107; cAMP response element binding and beta tranducin family; FLJ11315; N143; Transcriptional unit N143; WD repeat protein; WD repeat-containing protein 9; WDR9
Target Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates multiple transcript variants encoding distinct isoforms. In mouse, this gene encodes a nuclear protein that has a polyglutamine-containing region that functions as a transcriptional activation domain which may regulate chromatin remodelling and associates with a component of the SWI/SNF chromatin remodelling complex.
Notification