-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BSN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 830-950 of human BSN (NP_003449.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BSN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 830-950 of human BSN (NP_003449.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07459A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BSN |
| Target Synonyms | ZNF231; BSN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 830-950 of human BSN (NP_003449.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPARAAELTDEDFMRRQILEMSAEEDNLEEDDTATSGRGLAKHGTQKGGPRPRPEPSQEPAALPKRRLPHNATTGYEELLPEGGSAEATDGSGTLQGGLRRFKTIELNSTGSYGHELDLGQ | Uniprot ID | Q9UPA5 |
Uniprot Id
Q9UPA5
Target Species
Human
Target Name
BSN
Target Full Name
Protein bassoon
Target Function
Scaffold protein of the presynaptic cytomatrix at the active zone (CAZ) which is the place in the synapse where neurotransmitter is released. After synthesis, participates in the formation of Golgi-derived membranous organelles termed Piccolo-Bassoon transport vesicles (PTVs) that are transported along axons to sites of nascent synaptic contacts. At the presynaptic active zone, regulates the spatial organization of synaptic vesicle cluster, the protein complexes that execute membrane fusion and compensatory endocytosis. Functions also in processes other than assembly such as the regulation of specific presynaptic protein ubiquitination by interacting with SIAH1 or the regulation of presynaptic autophagy by associating with ATG5. Mediates also synapse to nucleus communication leading to reconfiguration of gene expression by associating with the transcriptional corepressor CTBP1 and by subsequently reducing the size of its pool available for nuclear import.
Target Subcellular Location
Cytoplasm. Cell junction, synapse, presynaptic active zone. Cytoplasm, cytoskeleton. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Peripheral membrane protein.
Target Tissue Specificity
Exclusively expressed in brain.
Target Synonyms
Bassoon protein; bsn; BSN_HUMAN; KIAA0434; Neuronal double zinc finger protein; Presynaptic cytomatrix protein; Protein bassoon; Zinc finger protein 231; ZNF 231; ZNF231
Target Background
Neurotransmitters are released from a specific site in the axon terminal called the active zone, which is composed of synaptic vesicles and a meshwork of cytoskeleton underlying the plasma membrane. The protein encoded by this gene is thought to be a scaffolding protein involved in organizing the presynaptic cytoskeleton. The gene is expressed primarily in neurons in the brain. A similar gene product in rodents is concentrated in the active zone of axon terminals and tightly associated with cytoskeletal structures, and is essential for regulating neurotransmitter release from a subset of synapses.
Notification