-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BVES was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 241-360 of human BVES (NP_001186492.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BVES was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 241-360 of human BVES (NP_001186492.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06558A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BVES |
| Target Synonyms | POP1; HBVES; CARICK; LGMD2X; POPDC1; LGMDR25; BVES | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 241-360 of human BVES (NP_001186492.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP | Uniprot ID | Q8NE79 |
Uniprot Id
Q8NE79
Target Species
Human
Target Name
POPDC1
Target Full Name
Popeye domain-containing protein 1
Target Function
Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3. Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading. Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density. Is also a caveolae-associated protein important for the preservation of caveolae structural and functional integrity as well as for heart protection against ischemia injury.
Target Involvement
Limb-girdle muscular dystrophy 2X (LGMD2X)
Target Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.
Target Protein Families
Popeye family
Target Tissue Specificity
Expressed in epithelial cells (at protein level). Expressed in fetal and adult heart and skeletal muscle.
Target Synonyms
BVES; POP1; POPDC1; Blood vessel epicardial substance; hBVES; Popeye domain-containing protein 1; Popeye protein 1
Target Background
This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in development of these tissues. The mouse ortholog may be involved in the regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Three transcript variants encoding the same protein have been found for this gene.
Notification