Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BZW2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-300 of human BZW2 (NP_054757.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BZW2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-300 of human BZW2 (NP_054757.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04809A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BZW2 |
| Target Synonyms | 5MP1; MST017; HSPC028; MSTP017; BZW2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, Jurkat | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-300 of human BZW2 (NP_054757.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTC | Uniprot ID | Q9Y6E2 |
Uniprot Id
Q9Y6E2
Target Species
Human
Target Name
BZW2
Target Full Name
eIF5-mimic protein 1
Target Function
May be involved in neuronal differentiation.
Target Protein Families
BZW family
Target Research Area
Cell Biology
Target Synonyms
Basic leucine zipper and W2 domain containing protein 2; Basic leucine zipper and W2 domain-containing protein 2; Basic leucine zipper and W2 domains 2; BZW 2; Bzw2; BZW2_HUMAN; HSPC028; MST017; MSTP017
Target Background
Enables cadherin binding activity. Predicted to be involved in cell differentiation and nervous system development. Located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
