-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against c-Jun was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-70 of human c-Jun (NP_002219.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against c-Jun was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-70 of human c-Jun (NP_002219.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12830A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | c-Jun |
| Target Synonyms | AP1; p39; AP-1; cJUN; c-Jun | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, NIH/3T3, 293T, MCF7, Mouse lung, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-70 of human c-Jun (NP_002219.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK | Uniprot ID | P05412 |
Uniprot Id
P05412
Target Species
Human
Target Name
JUN
Target Full Name
Transcription factor Jun
Target Function
Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells. Binds to the USP28 promoter in colorectal cancer (CRC) cells.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Jun subfamily
Target Tissue Specificity
Expressed in the developing and adult prostate and prostate cancer cells.
Target Research Area
Cardiovascular
Target Synonyms
Activator protein 1; AP 1; AP-1; AP1; cJun; Enhancer Binding Protein AP1; Jun Activation Domain Binding Protein; JUN; Jun oncogene; JUN protein; Jun proto oncogene; JUN_HUMAN; JUNC; Oncogene JUN; p39; Proto oncogene c jun; Proto oncogene cJun; Proto-oncogene c-jun; Transcription Factor AP 1; Transcription factor AP-1; Transcription Factor AP1; V jun avian sarcoma virus 17 oncogene homolog; V jun sarcoma virus 17 oncogene homolog (avian); V jun sarcoma virus 17 oncogene homolog; V-jun avian sarcoma virus 17 oncogene homolog; vJun Avian Sarcoma Virus 17 Oncogene Homolog
Target Background
This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Notification