-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against c-Myc was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA, CUT&Tag.
The antibody against c-Myc was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA, CUT&Tag.
| Cat.No | ADA-17273A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | c-MYC |
| Target Synonyms | MRTL; MYCC; c-Myc; bHLHe39; yc | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT 116, Jurkat, MCF7, Mouse ovary | Application | ELISA, WB, ChIP, CUT&Tag, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE | Uniprot ID | P01106 |
Uniprot Id
P01106
Target Species
Human
Target Name
MYC
Target Full Name
Myc proto-oncogene protein
Target Function
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release.
Target Involvement
Burkitt lymphoma (BL)
Target Subcellular Location
Nucleus, nucleoplasm. Nucleus, nucleolus.
Target Research Area
Epigenetics and Nuclear Signaling, Transcription
Target Synonyms
AU016757; Avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; Cellular myelocytomatosis oncogene; Class E basic helix-loop-helix protein 39; MGC105490; MRTL; Myc; Myc protein; Myc proto oncogene protein; Myc proto-oncogene protein; myc-related translation/localization regulatory factor; MYC_HUMAN; Myc2; myca; MYCC; Myelocytomatosis oncogene a; Myelocytomatosis oncogene; Niard; Nird; oncogene c-Myc; Oncogene Myc; OTTHUMP00000158589; OTTHUMP00000227763; Proto-oncogene c-Myc; Protooncogene homologous to myelocytomatosis virus; RNCMYC; Transcription factor p64; Transcriptional regulator Myc-A; V-Myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog (avian); zc-myc
Target Background
This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.
Notification