Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C10orf32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human C10orf32 (NP_653192.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against C10orf32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human C10orf32 (NP_653192.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of Rat brain, using C10orf32 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-02597A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C10orf32 |
| Target Synonyms | C10orf32 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human C10orf32 (NP_653192.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLL | Uniprot ID | Q96B45 |
Uniprot Id
Q96B45
Target Species
Human
Target Name
BORCS7
Target Full Name
BLOC-1-related complex subunit 7
Target Function
As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.
Target Subcellular Location
Lysosome membrane.
Target Protein Families
BORCS7 family
Target Synonyms
BORCS7; C10orf32BLOC-1-related complex subunit 7; Diaskedin
Target Background
Part of BORC complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
