-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C4BPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4BPA (NP_000706.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C4BPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4BPA (NP_000706.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02391A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C4BPA |
| Target Synonyms | PRP; C4BP; C4BPA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse plasma | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4BPA (NP_000706.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL | Uniprot ID | P04003 |
Uniprot Id
P04003
Target Species
Human
Target Name
C4BPA
Target Full Name
C4b-binding protein alpha chain
Target Function
Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Chylomicrons in the plasma.
Target Research Area
Immunology
Target Synonyms
C4b-binding protein alpha chain; C4bp; C4bpa; C4BPA_HUMAN; Complement component 4 binding protein alpha; Complement component 4 binding protein; Proline-rich protein; PrP; RP11-164O23.4
Target Background
This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster.
Notification