Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C5AR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 258-337 of human C5AR2 (NP_060955.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C5AR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 258-337 of human C5AR2 (NP_060955.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09104A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C5AR2 |
| Target Synonyms | C5L2; GPF77; GPR77; C5AR2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 258-337 of human C5AR2 (NP_060955.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VAAPNSALLARALRAEPLIVGLALAHSCLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSEMEV | Uniprot ID | Q9P296 |
Uniprot Id
Q9P296
Target Species
Human
Target Name
C5AR2
Target Full Name
C5a anaphylatoxin chemotactic receptor 2
Target Function
Receptor for the chemotactic and inflammatory C3a, C4a and C5a anaphylatoxin peptides and also for their dearginated forms ASP/C3adesArg, C4adesArg and C5adesArg respectively. Couples weakly to G(i)-mediated signaling pathways.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Frontal cortex, hippocampus, hypothalamus, pons and liver.
Target Synonyms
C5AR2; C5L2; GPR77; C5a anaphylatoxin chemotactic receptor 2; Complement component 5a receptor 2; G-protein coupled receptor 77
Target Background
This gene encodes a G-protein coupled receptor 1 family member involved in the complement system of the innate immune response. Unlike classical G-protein coupled receptors, the encoded protein does not associate with intracellular G-proteins. It may instead modulate signal transduction through the beta-arrestin pathway, and may alternatively act as a decoy receptor. This gene may be involved in coronary artery disease and in the pathogenesis of sepsis. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
