Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C9orf114 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-340 of human C9orf114 (NP_057474.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against C9orf114 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-340 of human C9orf114 (NP_057474.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07263A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C9orf114 |
| Target Synonyms | CENP32; CENP-32; HSPC109; C9orf114 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 163-340 of human C9orf114 (NP_057474.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYV | Uniprot ID | Q5T280 |
Uniprot Id
Q5T280
Target Species
Human
Target Name
SPOUT1
Target Full Name
Putative methyltransferase C9orf114
Target Function
Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. Also involved in chromosome alignment. May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis. Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level.
Target Subcellular Location
Cytoplasm, cytoskeleton, spindle. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Class IV-like SAM-binding methyltransferase superfamily
Target Synonyms
SPOUT1; C9orf114Putative methyltransferase C9orf114; EC 2.1.1.-; Centromere protein 32; CENP-32; Kinetochore-associated protein; SPOUT domain-containing methyltransferase 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
