-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CABP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CABP1 (NP_001028849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CABP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CABP1 (NP_001028849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07282A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CABP1 |
| Target Synonyms | CALBRAIN; HCALB_BR; CABP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CABP1 (NP_001028849.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGGGDGAAFKRPGDGARLQRVLGLGSRREPRSLPAGGPAPRRTAPPPPGHASAGPAAMSSHIAKSESKTSLLKAAAAAASGGSRAPRHGPARDPGLPSRR | Uniprot ID | Q9NZU7 |
Uniprot Id
Q9NZU7
Target Species
Human
Target Name
CABP1
Target Full Name
Calcium-binding protein 1
Target Function
Modulates calcium-dependent activity of inositol 1,4,5-triphosphate receptors (ITPRs)(PubMed:14570872). Inhibits agonist-induced intracellular calcium signaling. Enhances inactivation and does not support calcium-dependent facilitation of voltage-dependent P/Q-type calcium channels. Causes calcium-dependent facilitation and inhibits inactivation of L-type calcium channels by binding to the same sites as calmodulin in the C-terminal domain of CACNA1C, but has an opposite effect on channel function. Suppresses the calcium-dependent inactivation of CACNA1D. Inhibits TRPC5 channels. Prevents NMDA receptor-induced cellular degeneration. Required for the normal transfer of light signals through the retina.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Cell junction, synapse, postsynaptic density.; [Isoform L-CaBP1]: Cytoplasm, cytoskeleton.; [Isoform S-CaBP1]: Cytoplasm, cell cortex. Cell membrane; Lipid-anchor. Note=S-CaBP1 is localized at or near the plasma membrane.
Target Tissue Specificity
Retina and brain. Somatodendritic compartment of neurons. Calbrain was found exclusively in brain where it is abundant in the hippocampus, habenular area in the epithalamus and in the cerebellum.
Target Synonyms
CABP 1; CaBP1; CABP1_HUMAN; Calbrain; Calcium binding protein 1; Calcium binding protein 5; Calcium-binding protein 1; Caldendrin; HCALB BR; HCALB_BR
Target Background
Calcium binding proteins are an important component of calcium mediated cellular signal transduction. This gene encodes a protein that belongs to a subfamily of calcium binding proteins which share similarity to calmodulin. The protein encoded by this gene regulates the gating of voltage-gated calcium ion channels. This protein inhibits calcium-dependent inactivation and supports calcium-dependent facilitation of ion channels containing voltage-dependent L-type calcium channel subunit alpha-1C. This protein also regulates calcium-dependent activity of inositol 1, 4, 5-triphosphate receptors, P/Q-type voltage-gated calcium channels, and transient receptor potential channel TRPC5. This gene is predominantly expressed in retina and brain. Alternative splicing results in multiple transcript variants encoding disinct isoforms.
Notification