-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CACNA2D2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human CACNA2D2 (NP_001167522.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CACNA2D2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human CACNA2D2 (NP_001167522.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10913A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CACNA2D2 |
| Target Synonyms | CASVDD; CACNA2D; CACNA2D2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human CACNA2D2 (NP_001167522.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGASAYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNK | Uniprot ID | Q9NY47 |
Uniprot Id
Q9NY47
Target Species
Human
Target Name
CACNA2D2
Target Full Name
Voltage-dependent calcium channel subunit alpha-2/delta-2
Target Function
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) and possibly T-type (CACNA1G). Overexpression induces apoptosis.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Calcium channel subunit alpha-2/delta family
Target Tissue Specificity
Predominantly present in cerebellar cortex. Present in various lung tumor cell lines, while it is absent in normal lung (at protein level). Highly expressed in heart, lung, testis, pancreas and skeletal muscle. Also expressed in kidney, liver, placenta an
Target Synonyms
Alpha 2 delta calcium channel subunit ; CA2D2_HUMAN; CACNA2D; Cacna2d2; Calcium channel, voltage-dependent, alpha 2/delta subunit 2; Calcium channel, voltage-dependent, alpha 2/delta subunit 2 gene 26; Calcium voltage gated channel auxiliary subunit alpha2delta 2; Gene 26; KIAA0558; LUAC11.1; Voltage-dependent calcium channel subunit alpha-2/delta-2; Voltage-dependent calcium channel subunit delta-2; Voltage-gated calcium channel subunit alpha-2/delta-2
Target Background
Calcium channels mediate the entry of calcium ions into the cell upon membrane polarization. This gene encodes the alpha-2/delta subunit of the voltage-dependent calcium channel complex. The complex consists of the main channel-forming subunit alpha-1, and auxiliary subunits alpha-2/delta, beta, and gamma. The auxiliary subunits function in the assembly and membrane localization of the complex, and modulate calcium currents and channel activation/inactivation kinetics. The subunit encoded by this gene undergoes post-translational cleavage to yield the extracellular alpha2 peptide and a membrane-anchored delta polypeptide. This subunit is a receptor for the antiepileptic drug, gabapentin. Mutations in this gene are associated with early infantile epileptic encephalopathy. Single nucleotide polymorphisms in this gene are correlated with increased sensitivity to opioid drugs. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification