Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CADM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-335 of human CADM2 (NP_001161147.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CADM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-335 of human CADM2 (NP_001161147.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02040A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CADM2 |
| Target Synonyms | NECL3; IGSF4D; Necl-3; synCAM2; SynCAM 2; CADM2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-335 of human CADM2 (NP_001161147.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPD | Uniprot ID | Q8N3J6 |
Uniprot Id
Q8N3J6
Target Species
Human
Target Name
CADM2
Target Full Name
Cell adhesion molecule 2
Target Function
Adhesion molecule that engages in homo- and heterophilic interactions with the other nectin-like family members, leading to cell aggregation. Important for synapse organization, providing regulated trans-synaptic adhesion. Preferentially binds to oligodendrocytes.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, synapse. Cell projection, axon. Note=Found in the axoplasm of myelinated axons.
Target Protein Families
Nectin family
Target Synonyms
CADM2; CADM2_HUMAN; Cell adhesion molecule 2; IgSF4D; Immunoglobulin superfamily member 4D; NECL 2; Necl 3; NECL-3; NECL2; Necl3; Nectin like protein 3; Nectin-like protein 3; synCAM 2; synCAM2
Target Background
This gene encodes a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. The encoded protein has three Ig-like domains and a cytosolic protein 4.1 binding site near the C-terminus. Proteins belonging to the protein 4.1 family crosslink spectrin and interact with other cytoskeletal proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
