Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CADPS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against CADPS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of CADPS in paraffin-embedded human breast cancer using CADPS Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-04383A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CADPS |
| Target Synonyms | CAPS; CAPS1; CADPS1; UNC-31; CADPS | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMIT | Uniprot ID | Q9ULU8 |
Uniprot Id
Q9ULU8
Target Species
Human
Target Name
CADPS
Target Full Name
Calcium-dependent secretion activator 1
Target Function
Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates catecholamine loading of DCVs. May specifically mediate the Ca(2+)-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles by acting as a PtdIns(4,5)P2-binding protein that acts at prefusion step following ATP-dependent priming and participates in DCVs-membrane fusion. However, it may also participate in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca(2+) triggering.
Target Subcellular Location
Cell junction, synapse. Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle membrane; Peripheral membrane protein.
Target Tissue Specificity
Specifically expressed in neural and endocrine secretory tissues. Expressed in brain and pancreas and at low level in heart. Also expressed in fetal heart, cerebellum, cerebral cortex, medulla, occipital pole, frontal and temporal lobes, and putamen, as w
Target Synonyms
CADPS; CAPS; CAPS1; KIAA1121Calcium-dependent secretion activator 1; Calcium-dependent activator protein for secretion 1; CAPS-1
Target Background
This gene encodes a novel neural/endocrine-specific cytosolic and peripheral membrane protein required for the Ca2+-regulated exocytosis of secretory vesicles. The protein acts at a stage in exocytosis that follows ATP-dependent priming, which involves the essential synthesis of phosphatidylinositol 4, 5-bisphosphate (PtdIns(4, 5)P2). Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
