-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caldesmon was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 694-793 of human Caldesmon (Q05682) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Caldesmon was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 694-793 of human Caldesmon (Q05682) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13435A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caldesmon |
| Target Synonyms | CDM; HCAD; LCAD; h-CD; H-CAD; L-CAD; NAG22; Caldesmon | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 694-793 of human Caldesmon (Q05682). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV | Uniprot ID | Q05682 |
Uniprot Id
Q05682
Target Species
Human
Target Name
CALD1
Target Full Name
Caldesmon
Target Function
Actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and nonmuscle cells (could act as a bridge between myosin and actin filaments). Stimulates actin binding of tropomyosin which increases the stabilization of actin filament structure. In muscle tissues, inhibits the actomyosin ATPase by binding to F-actin. This inhibition is attenuated by calcium-calmodulin and is potentiated by tropomyosin. Interacts with actin, myosin, two molecules of tropomyosin and with calmodulin. Also plays an essential role during cellular mitosis and receptor capping. Involved in Schwann cell migration during peripheral nerve regeneration.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, myofibril. Cytoplasm, cytoskeleton, stress fiber.
Target Protein Families
Caldesmon family
Target Tissue Specificity
High-molecular-weight caldesmon (isoform 1) is predominantly expressed in smooth muscles, whereas low-molecular-weight caldesmon (isoforms 2, 3, 4 and 5) are widely distributed in non-muscle tissues and cells. Not expressed in skeletal muscle or heart.
Target Synonyms
CAD; CALD 1; CALD1; CALD1_HUMAN; Caldesmon 1; Caldesmon 1 Isoform 1; Caldesmon 1 Isoform 2; Caldesmon 1 Isoform 3; Caldesmon 1 Isoform 4; Caldesmon 1 Isoform 5; Caldesmon; Caldesmon1; CDM; H CAD; HCAD; L CAD; LCAD; MGC21352; NAG22
Target Background
This gene encodes a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Notification