Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CALHM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 202-346 of human CALHM1 (NP_001001412.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CALHM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 202-346 of human CALHM1 (NP_001001412.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01910A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CALHM1 |
| Target Synonyms | FAM26C; CALHM1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, SH-SY5Y, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 202-346 of human CALHM1 (NP_001001412.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV | Uniprot ID | Q8IU99 |
Uniprot Id
Q8IU99
Target Species
Human
Target Name
CALHM1
Target Full Name
Calcium homeostasis modulator protein 1
Target Function
Pore-forming subunit of a voltage-gated ion channel required for sensory perception of sweet, bitter and umami tastes. Specifically present in type II taste bud cells, where it plays a central role in sweet, bitter and umami taste perception by inducing ATP release from the cell, ATP acting as a neurotransmitter to activate afferent neural gustatory pathways. Together with CALHM3, forms a fast-activating voltage-gated ATP-release channel in type II taste bud cells (TBCs). Acts both as a voltage-gated and calcium-activated ion channel: mediates neuronal excitability in response to changes in extracellular Ca(2+) concentration. Has poor ion selectivity and forms a wide pore (around 14 Angstroms) that mediates permeation of Ca(2+), Na(+) and K(+), as well as permeation of monovalent anions. Acts as an activator of the ERK1 and ERK2 cascade. Triggers endoplasmic reticulum stress by reducing the calcium content of the endoplasmic reticulum. May indirectly control amyloid precursor protein (APP) proteolysis and aggregated amyloid-beta (Abeta) peptides levels in a Ca(2+) dependent manner.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
CALHM family
Target Tissue Specificity
Predominantly expressed in adult brain. Detected also in retinoic acid-differentiated SH-SY5Y cells. Specifically expressed in circumvallate taste bud cells.
Target Synonyms
CALHM1; FAM26C; Calcium homeostasis modulator protein 1; Protein FAM26C
Target Background
This gene encodes a calcium channel that plays a role in processing of amyloid-beta precursor protein. A polymorphism at this locus has been reported to be associated with susceptibility to late-onset Alzheimer's disease in some populations, but the pathogenicity of this polymorphism is unclear.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
