Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calmegin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-350 of human Calmegin (O14967) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Calmegin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-350 of human Calmegin (O14967) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14263A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calmegin |
| Target Synonyms | CLGN; Calmegin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, PC-3, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-350 of human Calmegin (O14967). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPA | Uniprot ID | O14967 |
Uniprot Id
O14967
Target Species
Human
Target Name
CLGN
Target Full Name
Calmegin
Target Function
Functions during spermatogenesis as a chaperone for a range of client proteins that are important for sperm adhesion onto the egg zona pellucida and for subsequent penetration of the zona pellucida. Required for normal sperm migration from the uterus into the oviduct. Required for normal male fertility. Binds calcium ions.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Protein Families
Calreticulin family
Target Tissue Specificity
Detected in testis (at protein level). Detected in testis.
Target Synonyms
CLGN; Calmegin
Target Background
Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
