-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calpain 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Calpain 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16620A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calpain 1 |
| Target Synonyms | CANP; muCL; CANP1; SPG76; CANPL1; muCANP; Calpain 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, U-937 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG | Uniprot ID | P07384 |
Uniprot Id
P07384
Target Species
Human
Target Name
CAPN1
Target Full Name
Calpain-1 catalytic subunit
Target Function
Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Proteolytically cleaves CTBP1 at 'Asn-375', 'Gly-387' and 'His-409'.
Target Involvement
Spastic paraplegia 76, autosomal recessive (SPG76)
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Protein Families
Peptidase C2 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Cell Biology
Target Synonyms
Ca2 activated neutral protease; Calcium activated neutral proteinase; Calcium activated neutral proteinase small subunit; Calcium dependent protease small subunit 1; Calcium dependent protease small subunit; Calcium-activated neutral proteinase 1; Calpain 1; Calpain 1 large subunit; Calpain 1; (mu/I) large subunit; Calpain mu type; Calpain mu-type; Calpain regulatory subunit; Calpain small subunit 1; Calpain; large polypeptide L1; Calpain-1 catalytic subunit; Calpain-1 large subunit; CAN1_HUMAN; CANP 1; CANP; CANP small subunit; CANP1; CANPL 1; CANPL1; CAPN 1; CAPN1; Cell proliferation inducing protein 30; Cell proliferation-inducing gene 30 protein; Micromolar Calpain; Micromolar-calpain; Mu Calpain; muCANP; muCL
Target Background
The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
Notification