-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calpain small subunit 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 69-268 of human Calpain small subunit 1 (NP_001740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Calpain small subunit 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 69-268 of human Calpain small subunit 1 (NP_001740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11097A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calpain small subunit 1 |
| Target Synonyms | CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4; Calpain small subunit 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, BT-474, Mouse lung, Mouse spleen, Rat lung, SKOV3, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 69-268 of human Calpain small subunit 1 (NP_001740.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS | Uniprot ID | P04632 |
Uniprot Id
P04632
Target Species
Human
Target Name
CAPNS1
Target Full Name
Calpain small subunit 1
Target Function
Regulatory subunit of the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Research Area
Signal Transduction
Target Synonyms
30K; Calcium activated neutral proteinase; Calcium activated neutral proteinase small subunit; Calcium dependent protease small subunit 1; Calcium dependent protease small subunit; Calcium-activated neutral proteinase small subunit; Calcium-dependent protease small subunit 1; Calcium-dependent protease small subunit; Calpain 4; Calpain 4 small subunit (30K); Calpain 4 small subunit; Calpain regulatory subunit; Calpain S1; Calpain small polypeptide; Calpain small subunit 1; Calpain4; CalpainS1; CANP; CANP small subunit; CANPS; CAPN 4; CAPN S1; CAPN4; CAPNS 1; CAPNS; Capns1; CDPS; CPNS1_HUMAN; CSS 1; CSS1
Target Background
This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants.
Notification