-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAMK2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human CAMK2A (NP_741960.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CAMK2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human CAMK2A (NP_741960.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12222A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAMK2A |
| Target Synonyms | CAMKA; MRD53; MRT63; CaMKIIalpha; CaMKIINalpha; CAMK2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CAMK2A (NP_741960.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFE | Uniprot ID | Q9UQM7 |
Uniprot Id
Q9UQM7
Target Species
Human
Target Name
CAMK2A
Target Full Name
Calcium/calmodulin-dependent protein kinase type II subunit alpha
Target Function
Calcium/calmodulin-dependent protein kinase that functions autonomously after Ca(2+)/calmodulin-binding and autophosphorylation, and is involved in synaptic plasticity, neurotransmitter release and long-term potentiation. Member of the NMDAR signaling complex in excitatory synapses, it regulates NMDAR-dependent potentiation of the AMPAR and therefore excitatory synaptic transmission. Regulates dendritic spine development. Also regulates the migration of developing neurons. Phosphorylates the transcription factor FOXO3 to activate its transcriptional activity. Acts as a negative regulator of 2-arachidonoylglycerol (2-AG)-mediated synaptic signaling via modulation of DAGLA activity.
Target Subcellular Location
Cell junction, synapse. Cell junction, synapse, postsynaptic density. Cell projection, dendritic spine. Cell projection, dendrite.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Target Synonyms
Calcium/calmodulin dependent protein kinase II alpha; Calcium/calmodulin dependent protein kinase II beta; Calcium/calmodulin dependent protein kinase II delta; Calcium/calmodulin dependent protein kinase II gamma; Calcium/calmodulin-dependent protein kinase type II subunit alpha; CaM kinase II alpha; CaM kinase II; CaM kinase II beta; CaM kinase II delta; CaM kinase II gamma; CaM kinase II subunit alpha; CaMK-II subunit alpha; CAMK2; Camk2a; CAMK2B; CAMK2D; CAMK2G; CAMKA; KCC2A_HUMAN
Target Background
The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene.
Notification