Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAMKK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 399-520 of human CAMKK1 (NP_757344.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CAMKK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 399-520 of human CAMKK1 (NP_757344.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10392A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAMKK1 |
| Target Synonyms | CAMKKA; CAMKK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, LO2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 399-520 of human CAMKK1 (NP_757344.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNLLV | Uniprot ID | Q8N5S9 |
Uniprot Id
Q8N5S9
Target Species
Human
Target Name
CAMKK1
Target Full Name
Calcium/calmodulin-dependent protein kinase kinase 1
Target Function
Calcium/calmodulin-dependent protein kinase that belongs to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Phosphorylates CAMK1, CAMK1D, CAMK1G and CAMK4. Involved in regulating cell apoptosis. Promotes cell survival by phosphorylating AKT1/PKB that inhibits pro-apoptotic BAD/Bcl2-antagonist of cell death.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Target Synonyms
CAMKK1; CAMKKA; Calcium/calmodulin-dependent protein kinase kinase 1; CaM-KK 1; CaM-kinase kinase 1; CaMKK 1; EC 2.7.11.17; CaM-kinase IV kinase; Calcium/calmodulin-dependent protein kinase kinase alpha; CaM-KK alpha; CaM-kinase kinase alpha; CaMKK alpha
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
