-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CANT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-231 of human CANT1 (NP_620148.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CANT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-231 of human CANT1 (NP_620148.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03073A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CANT1 |
| Target Synonyms | DBQD; EDM7; DBQD1; SCAN1; SHAPY; SCAN-1; CANT1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 62-231 of human CANT1 (NP_620148.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HRPAPGRPPTHNAHNWRLGQAPANWYNDTYPLSPPQRTPAGIRYRIAVIADLDTESRAQEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVKDERLYVGGLGK | Uniprot ID | Q8WVQ1 |
Uniprot Id
Q8WVQ1
Target Species
Human
Target Name
CANT1
Target Full Name
Soluble calcium-activated nucleotidase 1
Target Function
Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP. Involved in proteoglycan synthesis.
Target Involvement
Desbuquois dysplasia 1 (DBQD1); Epiphyseal dysplasia, multiple, 7 (EDM7)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein. Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Cell membrane. Note=Processed form: Secreted.
Target Protein Families
Apyrase family
Target Tissue Specificity
Widely expressed.
Target Synonyms
Apyrase; Apyrase homolog; Ca2+ dependent endoplasmic reticulum nucleoside diphosphatase; Calcium activated nucleotidase 1; CANT 1; CANT1; CANT1_HUMAN; Putative MAPK activating protein PM09; Putative MAPK-activating protein PM09; Putative NF kappa B activating protein 107; Putative NF-kappa-B-activating protein 107; SCAN 1; SCAN-1; SHAPY; Soluble Ca activated nucleotidase isozyme 1; Soluble calcium activated nucleotidase 1; Soluble calcium activated nucleotidase SCAN 1; Soluble calcium-activated nucleotidase 1
Target Background
This protein encoded by this gene belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Mutations in this gene are associated with Desbuquois dysplasia with hand anomalies. Alternatively spliced transcript variants have been noted for this gene.
Notification