Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CARD19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CARD19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03504A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CARD19 |
| Target Synonyms | BinCARD; C9orf89; CARD19 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, A-431, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA | Uniprot ID | Q96LW7 |
Uniprot Id
Q96LW7
Target Species
Human
Target Name
CARD19
Target Full Name
Caspase recruitment domain-containing protein 19
Target Function
Plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit the phosphorylation of BCL10 in a CARD-dependent manner.
Target Subcellular Location
[Isoform 1]: Nucleus. Note=Coexpression with BCL10 induced translocation from nucleus to cytosol.; [Isoform 2]: Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Target Tissue Specificity
Expressed in ovary, testis, placenta, skeletal muscle, kidney, lung, heart and liver (at protein level). Expressed in thymus and brain.
Target Synonyms
Bcl10 interacting protein with CARD protein; Bcl10-interacting CARD protein; BINCA_HUMAN; BinCARD; C9orf89; Chromosome 9 open reading frame 89
Target Background
Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
