-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Casein Kinase 1 alpha (CSNK1A1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (CSNK1A1) (NP_001883.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Casein Kinase 1 alpha (CSNK1A1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (CSNK1A1) (NP_001883.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09986A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Casein Kinase 1 alpha (CSNK1A1) |
| Target Synonyms | CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p; Casein Kinase 1 alpha (CSNK1A1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse brain, PC-3, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (CSNK1A1) (NP_001883.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF | Uniprot ID | P48729 |
Uniprot Id
P48729
Target Species
Human
Target Name
CSNK1A1
Target Full Name
Casein kinase I isoform alpha
Target Function
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis. May play a role in keratin cytoskeleton disassembly and thereby, it may regulate epithelial cell migration.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Chromosome, centromere, kinetochore. Nucleus speckle. Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, Casein kinase I subfamily
Target Research Area
Cell Cycle
Target Synonyms
Casein kinase 1 alpha 1; Casein kinase I isoform alpha; CK1; CK1A; CKI alpha; CKI-alpha; CKIa; Clock regulator kinase; Csnk1a1; Down regulated in lung cancer ; HLCDGP1; KC1A_HUMAN; PRO2975
Target Background
Enables protein serine/threonine kinase activity. Involved in several processes, including negative regulation of canonical Wnt signaling pathway; peptidyl-serine phosphorylation; and positive regulation of proteasomal ubiquitin-dependent protein catabolic process. Located in centrosome; cytosol; and nuclear speck. Part of beta-catenin destruction complex. Colocalizes with keratin filament and mRNA cleavage and polyadenylation specificity factor complex. Biomarker of Alzheimer's disease and inclusion body myositis.
Notification