-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caspase-12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Caspase-12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12845A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caspase-12 |
| Target Synonyms | CASP-12; CASP12P1; Caspase-12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS | Uniprot ID | Q6UXS9 |
Uniprot Id
Q6UXS9
Target Species
Human
Target Name
CASP12
Target Full Name
Inactive caspase-12
Target Function
Has no protease activity. May reduce cytokine release in response to bacterial lipopolysaccharide during infections. Reduces activation of NF-kappa-B in response to TNF.
Target Protein Families
Peptidase C14A family
Target Tissue Specificity
Detected in heart, kidney, liver, lung, pancreas, small intestine, spleen, stomach, thymus and testis.
Target Synonyms
CASP 12; CASP-12; Casp12; CASP12P1; caspase 12 (gene/pseudogene); caspase 12 pseudogene 1; CASPC_HUMAN; Inactive caspase-12; OTTHUMP00000207032
Target Background
Caspases are cysteine proteases that cleave C-terminal aspartic acid residues on their substrate molecules. This gene is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. In rodents, the homolog of this gene mediates apoptosis in response to endoplasmic reticulum stress. However, in humans this gene contains a polymorphism for the presence or absence of a premature stop codon. The majority of human individuals have the premature stop codon and produce a truncated non-functional protein. The read-through codon occurs primarily in individuals of African descent and carriers have endotoxin hypo-responsiveness and an increased susceptibility to severe sepsis. Several alternatively spliced transcript variants have been noted for this gene.
Notification