-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caspase-14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Caspase-14 (P31944) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Caspase-14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Caspase-14 (P31944) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14064A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caspase-14 |
| Target Synonyms | ARCI12; Caspase-14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, Mouse stomach, Mouse thymus, Rat lung, Rat stomach, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Caspase-14 (P31944). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKG | Uniprot ID | P31944 |
Uniprot Id
P31944
Target Species
Human
Target Name
CASP14
Target Full Name
Caspase-14
Target Function
Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum. Seems to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin. In vitro has a preference for the substrate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF. Involved in processing of prosaposin in the epidermis. May be involved in retinal pigment epithelium cell barrier function. Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD.
Target Involvement
Ichthyosis, congenital, autosomal recessive 12 (ARCI12)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Peptidase C14A family
Target Tissue Specificity
Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum) (at protein level). Expressed in keratinocytes of hair shaft and sebaceous glands (at protein level). In psoriatic skin only exp
Target Research Area
Cell Biology
Target Synonyms
Apoptosis related cysteine protease; CASP 14; CASP-14; CASP14; Caspase 14 apoptosis related cysteine protease; Caspase 14 precursor; Caspase-14 subunit p10; Caspase14; CASPE_HUMAN; MGC119078; MGC119079; MICE; Mini ICE
Target Background
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier.
Notification