-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caspr2/CNTNAP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1232-1331 of human Caspr2/CNTNAP2 (Q9UHC6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Caspr2/CNTNAP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1232-1331 of human Caspr2/CNTNAP2 (Q9UHC6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14354A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caspr2/CNTNAP2 |
| Target Synonyms | CDFE; NRXN4; AUTS15; CASPR2; PTHSL1; Caspr2/CNTNAP2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse spinal cord | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1232-1331 of human Caspr2/CNTNAP2 (Q9UHC6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLDHLDSASADFPYNPGQGQAIRNGVNRNSAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI | Uniprot ID | Q9UHC6 |
Uniprot Id
Q9UHC6
Target Species
Human
Target Name
CNTNAP2
Target Full Name
Contactin-associated protein-like 2
Target Function
Required for gap junction formation (Probable). Required, with CNTNAP1, for radial and longitudinal organization of myelinated axons. Plays a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Demarcates the juxtaparanodal region of the axo-glial junction.
Target Involvement
Autism 15 (AUTS15); Pitt-Hopkins-like syndrome 1 (PTHSL1)
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell projection, axon. Cell junction, paranodal septate junction.
Target Protein Families
Neurexin family
Target Tissue Specificity
Predominantly expressed in nervous system.
Target Research Area
Neuroscience
Target Synonyms
AUTS15; CDFE; Cell recognition molecule Caspr2; CNTNAP2; CNTP2; CNTP2_HUMAN; Contactin-associated protein-like 2; Homolog of Drosophila neurexin IV; NRXN4; PTHSL1
Target Background
This gene encodes a member of the neurexin family which functions in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, thrombospondin N-terminal-like domains and a putative PDZ binding site. This protein is localized at the juxtaparanodes of myelinated axons, and mediates interactions between neurons and glia during nervous system development and is also involved in localization of potassium channels within differentiating axons. This gene encompasses almost 1.5% of chromosome 7 and is one of the largest genes in the human genome. It is directly bound and regulated by forkhead box protein P2, a transcription factor related to speech and language development. This gene has been implicated in multiple neurodevelopmental disorders, including Gilles de la Tourette syndrome, schizophrenia, epilepsy, autism, ADHD and intellectual disability.
Notification