-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cathepsin D was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 313-412 of human Cathepsin D (P07339) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Cathepsin D was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 313-412 of human Cathepsin D (P07339) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16979A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cathepsin D |
| Target Synonyms | CPSD; CLN10; HEL-S-130P; Cathepsin D | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A375, HepG2, MCF7, Mouse brain, Mouse spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 313-412 of human Cathepsin D (P07339). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL | Uniprot ID | P07339 |
Uniprot Id
P07339
Target Species
Human
Target Name
CTSD
Target Full Name
Cathepsin D
Target Function
Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Target Involvement
Ceroid lipofuscinosis, neuronal, 10 (CLN10)
Target Subcellular Location
Lysosome. Melanosome. Secreted, extracellular space.
Target Protein Families
Peptidase A1 family
Target Tissue Specificity
Expressed in the aorta extracellular space (at protein level). Expressed in liver (at protein level).
Target Research Area
Neuroscience
Target Synonyms
CatD; CATD_HUMAN; Cathepsin D; Cathepsin D heavy chain; CD; Ceroid lipofuscinosis neuronal 10; CLN10; CPSD; ctsd; Epididymis secretory sperm binding protein Li 130P; HEL S 130P; Lysosomal aspartyl peptidase; Lysosomal aspartyl protease; MGC2311
Target Background
This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease.
Notification