Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cathepsin G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-190 of human Cathepsin G (NP_001902.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Cathepsin G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-190 of human Cathepsin G (NP_001902.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03482A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cathepsin G |
| Target Synonyms | CG; CATG; Cathepsin G | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 75-190 of human Cathepsin G (NP_001902.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDR | Uniprot ID | P08311 |
Uniprot Id
P08311
Target Species
Human
Target Name
CTSG
Target Full Name
Cathepsin G
Target Function
Serine protease with trypsin- and chymotrypsin-like specificity. Cleaves complement C3. Cleaves vimentin. Has antibacterial activity against the Gram-negative bacterium P.aeruginosa.
Target Subcellular Location
Cell surface. Membrane; Peripheral membrane protein.
Target Protein Families
Peptidase S1 family
Target Research Area
Neuroscience
Target Synonyms
CATG; CATG_HUMAN; Cathepsin G; Cathepsin G precursor; CathepsinG; CG; Ctsg; CTSG protein; MGC23078
Target Background
The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. In addition, the encoded protein is antimicrobial, with bacteriocidal activity against S. aureus and N. gonorrhoeae. Transcript variants utilizing alternative polyadenylation signals exist for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
