-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CBX4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 461-560 of human CBX4 (O00257) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against CBX4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 461-560 of human CBX4 (O00257) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-16616A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CBX4 |
| Target Synonyms | PC2; NBP16; CBX4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 22Rv1, K-562, MCF7, Mouse brain | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 461-560 of human CBX4 (O00257). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV | Uniprot ID | O00257 |
Uniprot Id
O00257
Target Species
Human
Target Name
CBX4
Target Full Name
E3 SUMO-protein ligase CBX4
Target Function
E3 SUMO-protein ligase which facilitates SUMO1 conjugation by UBE2I. Involved in the sumoylation of HNRNPK, a p53/TP53 transcriptional coactivator, hence indirectly regulates p53/TP53 transcriptional activation resulting in p21/CDKN1A expression. Monosumoylates ZNF131.; Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Binds to histone H3 trimethylated at 'Lys-9' (H3K9me3). Plays a role in the lineage differentiation of the germ layers in embryonic development.
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
CBX 4; CBX4; Cbx4 chromobox homolog 4 (Drosophila Pc class); CBX4_HUMAN; Chromobox homolog 4 (Pc class homolog; Drosophila); Chromobox homolog 4; Chromobox protein homolog 4; E3 SUMO protein ligase CBX 4; E3 SUMO protein ligase CBX4; E3 SUMO-protein ligase CBX4; hPc 2; hPc2; NBP 16; NBP16; NS5ATP1 binding protein 16; Pc 2; Pc class 2 homolog; Pc class homolog; Pc class homolog Drosophila; PC2; Polycomb 2 homolog
Target Background
Enables SUMO binding activity; SUMO ligase activity; and enzyme binding activity. Involved in negative regulation of transcription by RNA polymerase II. Located in nuclear body. Part of PRC1 complex. Implicated in hepatocellular carcinoma. Biomarker of hepatocellular carcinoma.
Notification