Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CBX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CBX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03755A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CBX6 |
| Target Synonyms | CBX6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV | Uniprot ID | O95503 |
Uniprot Id
O95503
Target Species
Human
Target Name
CBX6
Target Full Name
Chromobox protein homolog 6
Target Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Possibly contributes to the target selectivity of the PRC1 complex by binding specific regions of chromatin. Recruitment to chromatin might occur in an H3K27me3-independent fashion. May have a PRC1-independent function in embryonic stem cells.
Target Subcellular Location
Nucleus. Chromosome.
Target Synonyms
Cbx 6; Cbx6; CBX6_HUMAN; Chromobox homolog 6; Chromobox protein homolog 6
Target Background
Predicted to enable single-stranded RNA binding activity. Involved in negative regulation of transcription by RNA polymerase II. Located in nucleus. Part of PcG protein complex. Biomarker of glioblastoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
