Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCDC50 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-147 of human CCDC50 (NP_777568.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCDC50 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-147 of human CCDC50 (NP_777568.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10528A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCDC50 |
| Target Synonyms | YMER; C3orf6; DFNA44; CCDC50 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, LO2, Mouse brain, Mouse lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-147 of human CCDC50 (NP_777568.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQAQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYE | Uniprot ID | Q8IVM0 |
Uniprot Id
Q8IVM0
Target Species
Human
Target Name
CCDC50
Target Full Name
Coiled-coil domain-containing protein 50
Target Function
Involved in EGFR signaling.
Target Involvement
Deafness, autosomal dominant, 44 (DFNA44)
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Isoform 1 and isoform 2 are coexpressed in placenta, liver, lung, kidney and pancreas. Only isoform 1 is detected in skeletal muscle, brain and heart.
Target Synonyms
C3orf6; C3orf6 YMER; CCD50_HUMAN; CCDC 50; Ccdc50; Chromosome 3 open reading frame 6; Coiled coil domain containing 50; Coiled coil domain containing protein 50; Coiled-coil domain-containing protein 50; Protein Ymer; Ymer; Ymer protein
Target Background
This gene encodes a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
